PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462878666
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 221aa    MW: 24312.8 Da    PI: 6.2672
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462878666genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.57.2e-161391856
               HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               +F+++++p++++r+ L+++lgL+ rq+k+WFqNrR+++k
  462878666  1 MFKECPHPDENQRAALSRELGLEPRQIKFWFQNRRTQMK 39
               69**********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.1E-4145IPR001356Homeobox domain
PfamPF000462.8E-13139IPR001356Homeobox domain
PROSITE profilePS5007114.722141IPR001356Homeobox domain
SuperFamilySSF466891.55E-13147IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-15147IPR009057Homeodomain-like
CDDcd000865.12E-14242No hitNo description
PRINTSPR000317.9E-51221IPR000047Helix-turn-helix motif
PROSITE patternPS0002701639IPR017970Homeobox, conserved site
PRINTSPR000317.9E-52137IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MFKECPHPDE NQRAALSREL GLEPRQIKFW FQNRRTQMKA QHERQDNCFL RAENDKIRCE  60
NITMREALRN IICPNCGGPP IGEDFFDEQK LRMENARLKE ELDRVSSITS KYLGRPFTQM  120
PPVPSMSVSS SLDLSVGGMA GVPGLGSPSL DQLDLLGAAV SSSAGMGGSP SSCPWRGVNK  180
WMEFFPGIVS KAHTVDILVN GMCGGNESLI LGNAAVESLL L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0668131e-135BT066813.2 Zea mays full-length cDNA clone ZM_BFb0073D09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008649207.12e-92PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T581e-87ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLG2J5S92e-92G2J5S9_MAIZE; Homeodomain leucine zipper family IV protein
STRINGSb10g006820.11e-91(Sorghum bicolor)
STRINGGRMZM2G004334_P013e-91(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP15929915
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.13e-62homeodomain GLABROUS 11